PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G234900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 182aa    MW: 19352 Da    PI: 10.2482
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G234900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.21e-1498159162
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         +ke +r +r+ +NR++A+  R+RKka++ eLe +v  Le+ N++L ++l++l++e + l++ 
  Sevir.4G234900.1.p  98 DKEHRRLKRLLRNRVSAQQARERKKAYLSELEVRVNDLEKRNSELEERLSTLQNENQMLRQI 159
                         58899****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.0E-1698162IPR004827Basic-leucine zipper domain
PfamPF001701.7E-1399160IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.656100163IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.44E-13102160No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-16102162No hitNo description
PROSITE patternPS000360105120IPR004827Basic-leucine zipper domain
CDDcd147041.73E-10112154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MQQDQTTSSL PSSSERSSSS APQTEEAREG MESDEEIRRV PEVGLELATG PSTSGRETAG  60
AAAAAAAGAG TSSDRGQSSS AAAQAASSAR RSGRSPADKE HRRLKRLLRN RVSAQQARER  120
KKAYLSELEV RVNDLEKRNS ELEERLSTLQ NENQMLRQIL KNTTVNRRGP GGGSSAGGDN  180
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A5e-16123162342Transcription factor HY5
2oqq_B5e-16123162342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3756948e-64AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965956.11e-122PREDICTED: transcription factor HY5
SwissprotO246461e-53HY5_ARATH; Transcription factor HY5
TrEMBLA0A0A9P7635e-66A0A0A9P763_ARUDO; Uncharacterized protein
STRINGSi018524m5e-65(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.13e-43bZIP family protein